PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030205
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 432aa    MW: 48253.6 Da    PI: 6.5606
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030205genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.11e-50111391128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yLkkkv+ +k++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat  g+Wkatg+dk ++  
  Lus10030205  11 VPPGFRFHPTEEELLHYYLKKKVSFEKIDL-DVIRDVDLNKLEPWDIQEKCKIgttPQNDWYFFSHKDKKYPTGTRTNRATIVGFWKATGRDKVIHG- 106
                  69****************************.9***************964444222455**********************************9999. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  Lus10030205 107 SGRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                  9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-557175IPR003441NAC domain
PROSITE profilePS5100555.22811175IPR003441NAC domain
PfamPF023651.2E-2612139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MSISVNGQSQ VPPGFRFHPT EEELLHYYLK KKVSFEKIDL DVIRDVDLNK LEPWDIQEKC  60
KIGTTPQNDW YFFSHKDKKY PTGTRTNRAT IVGFWKATGR DKVIHGSGRR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD NAAGHKSSSF SVSSSNFLGE SGQEEGWVVC RIFKKKNLQK  180
PVVGPTTAIV NNTTSSIVAF AATNATFIAH TKSAINMFNS CDECELDKII QYVGNSCKEE  240
RYSNSQPLAN DGYHHYNSYK DGRCDFLKLP NLESPNCSPA GYPKMVNKAA FAVENDTNRV  300
SHNKNPVRYP VESMGLTTSW AALDQLVASQ LNGQHEYPVP TAATNVAYCG PSDFYDDHEQ  360
NDGDDDDEVD GPDVPLPPNG IMMNSNNNQP YDDHHQEYNV SNRNEIIDLG SFGARSTTAA  420
SSNGVPYYAT C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-4751779170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083111.11e-134PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-121NAC43_ARATH; NAC domain-containing protein 43
TrEMBLR4N7K11e-134R4N7K1_JATCU; NAC transcription factor 012
STRINGPOPTR_0002s17950.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-124NAC family protein